Transcript | Ll_transcript_148028 |
---|---|
CDS coordinates | 624-926 (+) |
Peptide sequence | MAFGLISAVSKLQMVSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALLIGLCTGVVILLLSGGTSSHVLVFSEDLFFIYLLPPIIFNAGSH* |
ORF Type | complete |
Blastp | Sodium/hydrogen exchanger 2 from Arabidopsis with 86.96% of identity |
---|---|
Blastx | Sodium/hydrogen exchanger 2 from Arabidopsis with 86.96% of identity |
Eggnog | Sodium hydrogen exchanger(COG0025) |
Kegg | Link to kegg annotations (AT3G05030) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427838.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer