Protein coding transcript 235264

• Transcript: Ll_transcript_148034
• CDS coordinates: 451-753 (+)
• Peptide sequence: MAFGLISAVSKLQMVSTSDHASVVSMNLFVALLCACIVIGHLLEENRWMNESITALLIGLCTGVVILLLSGGTSSHVLVFSEDLFFIYLLPPIIFNAGSH*
• ORF Type: complete

Annotations of Ll_transcript_148034

• Blastp: Sodium/hydrogen exchanger 2 from Arabidopsis with 86.96% of identity
• Blastx: Sodium/hydrogen exchanger 2 from Arabidopsis with 86.96% of identity
• Eggnog: Sodium hydrogen exchanger(COG0025)
• Kegg: Link to kegg annotations (AT3G05030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427838.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;