Protein coding transcript 235267

• Transcript: Ll_transcript_148038
• CDS coordinates: 299-688 (+)
• Peptide sequence: MMIMQVLNQDETPLLYSLVFGEGVVNDATSVVLFNAIQSFDLEQIDTSIASQFITNFLYLFVTSTLLGVLSGLLSAYIIKKLYIGRHSTDREVALMMLMAYLSYMLAELCYLSGILTVFFCGIVMSHYTW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_148038

• Blastp: Sodium/hydrogen exchanger 3 from Arabidopsis with 81.89% of identity
• Blastx: Sodium/hydrogen exchanger 2 from Arabidopsis with 82.68% of identity
• Eggnog: Sodium hydrogen exchanger(COG0025)
• Kegg: Link to kegg annotations (AT3G06370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427838.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;