Transcript | Ll_transcript_148126 |
---|---|
CDS coordinates | 282-1001 (+) |
Peptide sequence | MWLQKNSSWDKKDGVNGIVAVGIDKDKGSQNALKWAIDHLLTRNNTVVLIHVNAKHASVTTPKAKGFGFNEHNSLVSKDPDDQTKEIFRPYRVFCARKDLHCKDVVIEDGDVARALIEYTSHSAIEHLVIGSSNKTGFLRFKGSDIPGTISKGAPDFCTIYVVSKGKIQSMRSASRPVPFVSPLLSQLPQTSLNSDQSDPPRVPLSGGSVKGERRPLEVPPRRSHDGTTDSFRFVACYL* |
ORF Type | complete |
Blastp | U-box domain-containing protein 35 from Arabidopsis with 32.08% of identity |
---|---|
Blastx | U-box domain-containing protein 35 from Arabidopsis with 32.08% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G25160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447515.1) |
Pfam | Universal stress protein family (PF00582.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer