Transcript | Ll_transcript_148132 |
---|---|
CDS coordinates | 147-617 (+) |
Peptide sequence | MRRLKLELKQTMEMYNTACKEALTAQQKAVELQRWKLEEERRLEEARLAEEAALAIAEKEKAKSKAAIEAAEAQKRIAELEAQKRLNAEMKALKEAEEKRRALDALGNIDVRYRRYSIEEIEAATEFFAESLKIGEGGYGPVFKCLLEHTPVAVKVL |
ORF Type | 3prime_partial |
Blastp | U-box domain-containing protein 52 from Arabidopsis with 44.52% of identity |
---|---|
Blastx | U-box domain-containing protein 52 from Arabidopsis with 44.3% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G61550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438369.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer