Protein coding transcript 235289

• Transcript: Ll_transcript_148132
• CDS coordinates: 147-617 (+)
• Peptide sequence: MRRLKLELKQTMEMYNTACKEALTAQQKAVELQRWKLEEERRLEEARLAEEAALAIAEKEKAKSKAAIEAAEAQKRIAELEAQKRLNAEMKALKEAEEKRRALDALGNIDVRYRRYSIEEIEAATEFFAESLKIGEGGYGPVFKCLLEHTPVAVKVL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_148132

• Blastp: U-box domain-containing protein 52 from Arabidopsis with 44.52% of identity
• Blastx: U-box domain-containing protein 52 from Arabidopsis with 44.3% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G61550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438369.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;