Protein coding transcript 235295

• Transcript: Ll_transcript_148117
• CDS coordinates: 282-1292 (+)
• Peptide sequence: MWLQKNSSWDKKDGVNGIVAVGIDKDKGSQNALKWAIDHLLTRNNTVVLIHVNAKHASVTTPKAKGFGFNEHNSLVSKDPDDQTKEIFRPYRVFCARKDLHCKDVVIEDGDVARALIEYTSHSAIEHLVIGSSNKTGFLRFKGSDIPGTISKGAPDFCTIYVVSKGKIQSMRSASRPVPFVSPLLSQLPQTSLNSDQSDPPRVPLSGGSVKGERRPLEVPPRRSHDGTTDSFRSPFTRKGMAERYVEISTSADSDITFVSSGRSSIDKLFPTLTNNNTSESCFSNPRLSYSSDTDANYSFESLNFGRRSIDITSPDHSFSSDGFSSSSQTTVRTNP*
• ORF Type: complete

Annotations of Ll_transcript_148117

• Blastp: U-box domain-containing protein 35 from Arabidopsis with 32.08% of identity
• Blastx: U-box domain-containing protein 35 from Arabidopsis with 32.08% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G25160)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447515.1)
• Pfam: Universal stress protein family (PF00582.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;