Protein coding transcript 235297

• Transcript: Ll_transcript_148119
• CDS coordinates: 395-1045 (+)
• Peptide sequence: MWLPKNNMEMKDGVNGLVAVAIDKEKGSQNALKWTIDHLLNRSSTVFLIHVKLKPGSLSTSPSLFGQRSVMHIADEGSVGKTDPDALNKNIFLPYRVFCTRKDIQCKDVLLEDVDVSKALIEYVCNAGIEHLVLGSSTKAGLFRKFKVLDIPGTVSKGAPDFCTVYVVAKGKINSMRSATRAAPVVSTMLSQFSEATTNSEPLEPHVPVVAASVKG*
• ORF Type: complete

Annotations of Ll_transcript_148119

• Blastp: U-box domain-containing protein 51 from Arabidopsis with 27.75% of identity
• Blastx: U-box domain-containing protein 51 from Arabidopsis with 27.75% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G61560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438369.1)
• Pfam: Universal stress protein family (PF00582.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;