Transcript | Ll_transcript_148978 |
---|---|
CDS coordinates | 209-985 (+) |
Peptide sequence | MMISSMQATLFGKASFFRQSSSLRSLTFFVPFSSSTASVSADNLSRKKWRQPVFSALELGGVKVSREDVVKDDPTNNVPDSIFSKLGLQLHRRDQHPLGILKNAIYDYFDTNYSNKFDKFDDLCPIVSVKQNFDDVLVPEGHVSRSLNDTYYIDPQTVLRCHTSAHQAELLRAGHTHFLVTGDVYRRDSIDSTHYPIFHQMEGFRVFVPDEWEASGMDATSFAAVDLKKCLEGLARHLFGISKWLIYTFHYQLLKFDN* |
ORF Type | complete |
Blastp | Phenylalanine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 69.71% of identity |
---|---|
Blastx | Phenylalanine--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 69.71% of identity |
Eggnog | phenylalanyL-tRNA synthetase, alpha subunit(COG0016) |
Kegg | Link to kegg annotations (AT3G58140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419283.1) |
Pfam | tRNA synthetases class II core domain (F) (PF01409.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer