Transcript | Ll_transcript_150596 |
---|---|
CDS coordinates | 3-383 (-) |
Peptide sequence | MEIALIQYANDISSEAHIEVMRKVKVGMKEYQLESMFLHHTYMYGGCRHCSYTCICPTDENSAILHFGSTTTPNDKTLEDGDIALIDMGAEYHFYGSDITCSFPLQNPFEFPSILRCFHRRYCSSHE |
ORF Type | 3prime_partial |
Blastp | Xaa-Pro dipeptidase from Homo with 59.63% of identity |
---|---|
Blastx | Xaa-Pro dipeptidase from Homo with 60.98% of identity |
Eggnog | peptidase M24(COG0006) |
Kegg | Link to kegg annotations (5184) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424363.1) |
Pfam | Metallopeptidase family M24 (PF00557.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer