Protein coding transcript 235333

• Transcript: Ll_transcript_148165
• CDS coordinates: 316-702 (+)
• Peptide sequence: MQGLDLASPEIETLKKEVRSMLVSTIEKPLIKVDLIDSICRLGLQYHFENEIEQVLQYIHNNYVENGEIIVEGNLHTLALIFRLLRQEGFMVSPNVFSKFWDVHQNFSESLTTDVEGMLNLYEASYLRI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_148165

• Blastp: Sesquiterpene synthase from Santalum with 47.93% of identity
• Blastx: Probable 5-epi-aristolochene synthase 4 from Nicotiana with 39.58% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437423.1)
• Pfam: Terpene synthase, N-terminal domain (PF01397.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;