Protein coding transcript 235349

• Transcript: Ll_transcript_147922
• CDS coordinates: 107-826 (+)
• Peptide sequence: MSHSHLLPSKRQGENLSDDGASATKPARLKISIPSDDAEKKNVNKRLKDVEICVPIVYGTIAFYLGRKASESQSHKWTVYVRGASNEDLGAVIKKVVFQLHPSFNNPTRVIESPPFELSECGWGEFEIHITLFLHNDVCDKQLDLYHHLKLYPEDESGPQSTKKPVVVESYNEIVFPEPSDGFLARVLNHPAVIVPRLPAGLNLPSPSKFLQMFFLFFSPFLHNDPFRFPPYFDQCSAN*
• ORF Type: complete

Annotations of Ll_transcript_147922

• Blastp: Transcription initiation factor TFIID subunit 14b from Arabidopsis with 65.83% of identity
• Blastx: Transcription initiation factor TFIID subunit 14b from Arabidopsis with 65.83% of identity
• Eggnog: myeloid lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)(COG5033)
• Kegg: Link to kegg annotations (AT5G45600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420187.1)
• Pfam: YEATS family (PF03366.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;