Protein coding transcript 235350

• Transcript: Ll_transcript_147897
• CDS coordinates: 167-472 (+)
• Peptide sequence: MTIIILCRKMTGIEYILSEVLEPHLFVIRKQKRDSPDKVTPMLAYYILDGSIYQAPQLCNVFAARIGRTLHHIQKAFTIAASKLEKIGYGKQRFSCELFYL*
• ORF Type: complete

Annotations of Ll_transcript_147897

• Blastp: Mediator of RNA polymerase II transcription subunit 6 from Arabidopsis with 74.68% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 6 from Arabidopsis with 74.68% of identity
• Eggnog: component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)(COG5097)
• Kegg: Link to kegg annotations (AT3G21350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430316.1)
• Pfam: MED6 mediator sub complex component (PF04934.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;