Transcript | Ll_transcript_147903 |
---|---|
CDS coordinates | 126-575 (+) |
Peptide sequence | MTIIILCRKMTGIEYILSEVLEPHLFVIRKQKRDSPDKVTPMLAYYILDGSIYQAPQLCNVFAARIGRTLHHIQKAFTIAASKLEKIGYVDSENESEVLESKVNKETIDLKEVKRIDMILASLQRKLPPAPPPPPFPEGYVPPPTSETEE |
ORF Type | 3prime_partial |
Blastp | Mediator of RNA polymerase II transcription subunit 6 from Arabidopsis with 54.6% of identity |
---|---|
Blastx | Mediator of RNA polymerase II transcription subunit 6 from Arabidopsis with 51.88% of identity |
Eggnog | component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity)(COG5097) |
Kegg | Link to kegg annotations (AT3G21350) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430316.1) |
Pfam | MED6 mediator sub complex component (PF04934.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer