Protein coding transcript 235359

• Transcript: Ll_transcript_150489
• CDS coordinates: 137-991 (+)
• Peptide sequence: MGSELIFRGHETQPVNDEDSPKPNKPWFTITRPIHYLLHEQRLLFILIGIAIATVFFVLVPSRSTPPPPSEPLSINYFKHESNQLAYKSNPLIGVHSIGKVPLGIKRKGLRIVVTGGAGFVGSHLVDRLIERGDSVMVIDNFFTGRKENVMHHFGNPRFELIRHDVVEPILLEVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPLEHPQKETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGAGVQVYIFHHLLHGF*
• ORF Type: complete

Annotations of Ll_transcript_150489

• Blastp: UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 72.98% of identity
• Blastx: UDP-glucuronic acid decarboxylase 2 from Arabidopsis with 72.98% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT3G62830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441743.1)
• Pfam: RmlD substrate binding domain (PF04321.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;