Protein coding transcript 235421

• Transcript: Ll_transcript_148809
• CDS coordinates: 269-898 (+)
• Peptide sequence: MSGPGGDAANSFVEGYSKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIRKRITDKKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKTCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVAKHEYLGEYTGELISHREADKRGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_148809

• Blastp: Histone-lysine N-methyltransferase CLF from Arabidopsis with 85.58% of identity
• Blastx: Histone-lysine N-methyltransferase CLF from Arabidopsis with 82.38% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT2G23380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444689.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;