Protein coding transcript 235458

• Transcript: Ll_transcript_148597
• CDS coordinates: 104-1147 (+)
• Peptide sequence: MTMDDECSIYVGGIPYDTTEDTIRTIFNLYGSILDVKIINDQRTAGKCYCFVTFTNPRSAIDAIDDMNGRSIGGRAVMVNGVKTRGGRSSFSREHQRRNMERNEDWDHGRGRDQDYYNDRVIYRDRHSDRSQERDRSQDHGRDRDRGFGHMHNHDHEKEPFVDKDRSRDEDCLDNKQGHNKAHGQGKEGEQNLDFGKWSKIDRTSDPDRSFGEDQNRHSRRSSGLYVTNQHSMDHLSDSNGSHDDQVDDQLKRSTQRLDQLKNEVSQMEEKLEEKRLLTLELQKKSRKLEDALVSVKKQSSYRQMQLIKLHKCVLQVKDYSERLKASEKELQALVDTTLLENDDVTG*
• ORF Type: complete

Annotations of Ll_transcript_148597

• Blastp: RNA-binding motif protein, X-linked 2 from Mus with 38.67% of identity
• Blastx: RNA-binding motif protein, X-linked 2 from Mus with 38.67% of identity
• Eggnog: RNA binding motif protein X-linked 2(ENOG4111KW0)
• Kegg: Link to kegg annotations (209003)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437495.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;