Protein coding transcript 23551

• Transcript: Ll_transcript_366814
• CDS coordinates: 24-470 (+)
• Peptide sequence: MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRTKYEATARSWTQKYAMG*
• ORF Type: complete

Annotations of Ll_transcript_366814

• Blastp: Ubiquitin-conjugating enzyme E2 8 from Arabidopsis with 97.3% of identity
• Blastx: Ubiquitin-conjugating enzyme E2 8 from Arabidopsis with 97.3% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT5G41700)
• CantataDB: Link to cantataDB annotations (CNT0002539)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412795.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;