Protein coding transcript 235547

• Transcript: Ll_transcript_148747
• CDS coordinates: 59-454 (+)
• Peptide sequence: MSSMLCASIYGGSSIKTGESYLRSKQYGKNHYATSYVPTLWHKTGKILKERCVMISSHHNLEHIYKVNNGGSTFQETQRRYDTKAISNHSSEYGPQFQDLKSISETIKKEFDIFYRFIRPYTTIPAVSNTF*
• ORF Type: complete

Annotations of Ll_transcript_148747

• Blastp: Naringenin 8-dimethylallyltransferase 2, chloroplastic from Sophora with 54.33% of identity
• Blastx: Naringenin 8-dimethylallyltransferase 2, chloroplastic from Sophora with 54.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418953.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;