Protein coding transcript 23558

• Transcript: Ll_transcript_365510
• CDS coordinates: 154-885 (+)
• Peptide sequence: MTTKLISCVIFDLDGTLLNTDGVVGNVLKLMLSKYGKEWDGRETLQVLGKTPFESAAAVVQQYALPCSATEFISQLSPLFYDQQRNIKALPGANRLLKHLKSHGVPMALASNSPRKSVEAKLSYHDGWKNSFSVIIGGDEVRTGKPSPEIFLEAARRLSVEPSNCLVIEDSLPGVTAGKAAGMEVVAVPSLPKQAHLYTAADEVISSLLDLQLKNWGLPPFEDCKSQTPSVILFVFYWHFTSI*
• ORF Type: complete

Annotations of Ll_transcript_365510

• Blastp: Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 63.71% of identity
• Blastx: Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 63.71% of identity
• Eggnog: riboflavin biosynthesis protein ribF(COG0196)
• Kegg: Link to kegg annotations (AT4G21470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431450.1)
• Pfam: haloacid dehalogenase-like hydrolase (PF00702.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;