Transcript | Ll_transcript_365511 |
---|---|
CDS coordinates | 603-1394 (+) |
Peptide sequence | MNLFLLLFSLLVGWKNSFSVIIGGDEVRTGKPSPEIFLEAARRLSVEPSNCLVIEDSLPGVTAGKAAGMEVVAVPSLPKQAHLYTAADEVISSLLDLQLKNWGLPPFEDWVEGTLPLDRWHIGGPVVKGFGRGSKILGIPTANLSAEGYSDLLQEHPAGVYFGWAGLSSRGVFKMVMSVGWNPYFNNKEKTFEPWLLHDFNEDFYGEELRLVIVGYIRPEANFPSLESLIAKIHEDRRFAEKALDLPLYSRYKNDSYLRSSQS* |
ORF Type | complete |
Blastp | Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 78.05% of identity |
---|---|
Blastx | Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 78.05% of identity |
Eggnog | riboflavin biosynthesis protein ribF(COG0196) |
Kegg | Link to kegg annotations (AT4G21470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431450.1) |
Pfam | Haloacid dehalogenase-like hydrolase (PF13419.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer