Transcript | Ll_transcript_149446 |
---|---|
CDS coordinates | 2975-3727 (+) |
Peptide sequence | MCFSVLVFFVRETSCKTSFFLDISASGMSSANEMHNYIARNDDHTAHQMFKDSQTIESTYDRYLQSGQPSSLPSGETSTTSALGLGRGGGRFPGYPLADPSVMGCHGGDGRDLTPNGRGVNYGSQLSVDAVYRPGPETIPLPPDASSTLYVEGLPSDCTKREVAHIFRPFVGYREVRLVSKESKHRGGDPLILCFVDFENPACAATAMSALQGYKVDELHPDSSYLRLQFSRYPGSRSGSGPGPGSRGKR* |
ORF Type | complete |
Blastp | RNA-binding protein 2 from Medicago with 68.83% of identity |
---|---|
Blastx | RNA-binding protein 2 from Medicago with 68.72% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (MTR_1g099190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413758.1) |
Pfam | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer