Protein coding transcript 235661

• Transcript: Ll_transcript_149448
• CDS coordinates: 3547-4299 (+)
• Peptide sequence: MCFSVLVFFVRETSCKTSFFLDISASGMSSANEMHNYIARNDDHTAHQMFKDSQTIESTYDRYLQSGQPSSLPSGETSTTSALGLGRGGGRFPGYPLADPSVMGCHGGDGRDLTPNGRGVNYGSQLSVDAVYRPGPETIPLPPDASSTLYVEGLPSDCTKREVAHIFRPFVGYREVRLVSKESKHRGGDPLILCFVDFENPACAATAMSALQGYKVDELHPDSSYLRLQFSRYPGSRSGSGPGPGSRGKR*
• ORF Type: complete

Annotations of Ll_transcript_149448

• Blastp: RNA-binding protein 2 from Medicago with 68.83% of identity
• Blastx: RNA-binding protein 2 from Medicago with 68.72% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_1g099190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413758.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;