Protein coding transcript 23567

• Transcript: Ll_transcript_365432
• CDS coordinates: 173-847 (+)
• Peptide sequence: MEEHSQEPPPQIPQTIIYDTLTPNSLSAATVSQLSDQPQPQPEPNSYSVFRNEISLDTIQCASSDIPAVDFFSLNVSDEPSAPDSLPEPEAPPAEVYEPKTPALAPEAKLESGWFRGNCKFKSPMLQLHKEIVDFSNFLLPTQEEKAARDTAIESVFGVIKHIWPHCQVEIFGSFRTGLYLPTSDIDVVILKAGLPNTQMGLNALSRALSQRGIAKKIQVCQIA*
• ORF Type: complete

Annotations of Ll_transcript_365432

• Blastp: Non-canonical poly(A) RNA polymerase protein Trf4-1 from Sophophora with 39.55% of identity
• Blastx: Non-canonical poly(A) RNA polymerase PAPD7 from Homo with 44.44% of identity
• Eggnog: domain) containing(COG5260)
• Kegg: Link to kegg annotations (Dmel_CG11265)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425299.1)
• Pfam: Nucleotidyltransferase domain (PF01909.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;