Transcript | Ll_transcript_365436 |
---|---|
CDS coordinates | 173-847 (+) |
Peptide sequence | MEEHSQEPPPQIPQTIIYDTLTPNSLSAATVSQLSDQPQPQPEPNSYSVFRNEISLDTIQCASSDIPAVDFFSLNVSDEPSAPDSLPEPEAPPAEVYEPKTPALAPEAKLESGWFRGNCKFKSPMLQLHKEIVDFSNFLLPTQEEKAARDTAIESVFGVIKHIWPHCQVEIFGSFRTGLYLPTSDIDVVILKAGLPNTQMGLNALSRALSQRGIAKKIQVCQIA* |
ORF Type | complete |
Blastp | Non-canonical poly(A) RNA polymerase protein Trf4-1 from Sophophora with 39.55% of identity |
---|---|
Blastx | Non-canonical poly(A) RNA polymerase PAPD5 from Homo with 40.71% of identity |
Eggnog | domain) containing(COG5260) |
Kegg | Link to kegg annotations (Dmel_CG11265) |
CantataDB | Link to cantataDB annotations (CNT0000375) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425299.1) |
Pfam | Nucleotidyltransferase domain (PF01909.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer