Protein coding transcript 23574

• Transcript: Ll_transcript_365422
• CDS coordinates: 317-1153 (+)
• Peptide sequence: MEEGNHESPKMPQTFVYQTLSPISLSATTTEPPPEPEPDPEPEPYSVFINSQLSDNPEPESYTVLRNEISHDTLQCASSDIPVVDFFSLNVDDELVAGDSIPEPKTPVTVTVEAKTHVVVPEAKLESGWFRGNCKFRSPMLQLHKEIVDFSEFLSPTPEEKAARDTAIESVFGVIRHIWPHCQVEVFGSFKTGLYLPTSDIDVVILKAGLPNPQMGLNALSRALSQRGIAKKIQVIGKARVPIIKFVEKKSGVSFDISFDIDNGPKAAEYIQVFKSGM*
• ORF Type: complete

Annotations of Ll_transcript_365422

• Blastp: Non-canonical poly(A) RNA polymerase PAPD7 from Homo with 44.29% of identity
• Blastx: Non-canonical poly(A) RNA polymerase PAPD7 from Homo with 44.29% of identity
• Eggnog: domain) containing(COG5260)
• Kegg: Link to kegg annotations (11044)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443955.1)
• Pfam: Nucleotidyltransferase domain (PF01909.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;