Protein coding transcript 235752

• Transcript: Ll_transcript_150684
• CDS coordinates: 445-939 (+)
• Peptide sequence: MGTNSEIKSPEGALYGTPQEGCSMMNRKKLGIYFKESEDRRMAFGRGYTAGSTPVNIHGNSILDLSKTGGWLAAFFIFGNEMAERMAYFGLSVNMVAFMFYVMHRPFSSSSNTVNNFLGISQASSVLGGFLADAFLGRYWTIAIFTTIYLVVCMWRNICFYNRK*
• ORF Type: complete

Annotations of Ll_transcript_150684

• Blastp: Protein NRT1/ PTR FAMILY 6.1 from Arabidopsis with 77.55% of identity
• Blastx: Protein NRT1/ PTR FAMILY 6.1 from Arabidopsis with 78.87% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT5G13400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003552744.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;