Protein coding transcript 235796

• Transcript: Ll_transcript_150202
• CDS coordinates: 1146-1457 (+)
• Peptide sequence: MYCILYELTGCITTKELGTVMRSLGQNPIEAEVQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNRGEKLTDE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_150202

• Blastp: Calmodulin-2/4 from Solanum with 96.84% of identity
• Blastx: Calmodulin-2/4 from Solanum with 96.84% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004491196.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;