Protein coding transcript 235799

• Transcript: Ll_transcript_150212
• CDS coordinates: 3-512 (+)
• Peptide sequence: KREGGTLQLYLWRRKKGFFRNNIEFFVQFLSFFFRKNREKEGKIIRSIIIYYNNTMADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGE
• ORF Type: internal

Annotations of Ll_transcript_150212

• Blastp: Calmodulin from Medicago with 100% of identity
• Blastx: Calmodulin from Medicago with 100% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004491196.1)
• Pfam: EF hand (PF00036.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;