Protein coding transcript 235800

• Transcript: Ll_transcript_150216
• CDS coordinates: 608-949 (+)
• Peptide sequence: MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMVREADVDGDGQINYDEFVKVMMAK*
• ORF Type: complete

Annotations of Ll_transcript_150216

• Blastp: Calmodulin-2/4 from Solanum with 99.12% of identity
• Blastx: Calmodulin-2/4 from Solanum with 99.19% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428596.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;