Protein coding transcript 23582

• Transcript: Ll_transcript_365449
• CDS coordinates: 2-784 (+)
• Peptide sequence: WAAQPVYKHEEALEEQWEEMVNLTTRLCWKFVKKDGYVAVWQKPSDNSCYLNREAGIKPPLCDPSDDPDNIWYVNLKACISQLPENGYGANVTRWPERLQTPSDRLQSIKIDAFISRKELFKAESKYWNEIIEGYVRALHWKKMKLRNVMDMRAGFGGFAAALIDHKLDSWVMNVVPVSGPNTLPVIFDRGLIGVMHDWCEPFDTYPRTYDLLHAANLLSVEKKRYPFLTSCSFILLHVNYYVFVLIRKKNEYCSESKPS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_365449

• Blastp: Probable methyltransferase PMT11 from Arabidopsis with 76.25% of identity
• Blastx: Probable methyltransferase PMT11 from Arabidopsis with 76.25% of identity
• Eggnog: Methyltransferase(ENOG410ZKVC)
• Kegg: Link to kegg annotations (AT2G39750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433127.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;