Transcript | Ll_transcript_149788 |
---|---|
CDS coordinates | 83-394 (+) |
Peptide sequence | MSFWKWGFVGILFATFVFTIGAVELGRNHLTERISGSAGDVLEDNPVGRLKVFVYELPSKYNKKILQKDPRCLTHMFAAEIFMHRFLLSSPVRTLNPKEADWFY |
ORF Type | 3prime_partial |
Blastp | Probable beta-1,4-xylosyltransferase IRX10L from Arabidopsis with 84.88% of identity |
---|---|
Blastx | Probable beta-1,4-xylosyltransferase IRX10L from Arabidopsis with 84.88% of identity |
Eggnog | Exostosin(ENOG410XTFH) |
Kegg | Link to kegg annotations (AT5G61840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415627.1) |
Pfam | Exostosin family (PF03016.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer