Protein coding transcript 235836

• Transcript: Ll_transcript_149788
• CDS coordinates: 83-394 (+)
• Peptide sequence: MSFWKWGFVGILFATFVFTIGAVELGRNHLTERISGSAGDVLEDNPVGRLKVFVYELPSKYNKKILQKDPRCLTHMFAAEIFMHRFLLSSPVRTLNPKEADWFY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_149788

• Blastp: Probable beta-1,4-xylosyltransferase IRX10L from Arabidopsis with 84.88% of identity
• Blastx: Probable beta-1,4-xylosyltransferase IRX10L from Arabidopsis with 84.88% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT5G61840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415627.1)
• Pfam: Exostosin family (PF03016.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;