Transcript | Ll_transcript_365443 |
---|---|
CDS coordinates | 439-891 (+) |
Peptide sequence | MKLRNVMDMRAGFGGFAAALIDWKLDCWVMNVVPVSGPNTLPVIYDRGLTGVMHDWCEPFDTYPRTYDLLHAANLLSVEKKRCNISSIMLEMNRILRPGGRAYIRDSLVIMDELVAIGKALGWRVTLRNTDEGPHSSYRVLVGDKRVRKV* |
ORF Type | complete |
Blastp | Probable methyltransferase PMT11 from Arabidopsis with 75.51% of identity |
---|---|
Blastx | Probable methyltransferase PMT11 from Arabidopsis with 74.77% of identity |
Eggnog | Methyltransferase(ENOG410ZKVC) |
Kegg | Link to kegg annotations (AT2G39750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459872.1) |
Pfam | Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer