Protein coding transcript 235869

• Transcript: Ll_transcript_150771
• CDS coordinates: 2-634 (+)
• Peptide sequence: SGTWYCKYCQNNFQMDKHGERNGSTVDRRCIRVVKSGEVDHGGCALCRGHYFSKSFGPRTVIICDQCEKEYHVGCLKDHNMQNLEELPEGNWFCGTSCNQIHSTLMNLVVGEKNLPVPDSLLNLIKKKHEEKGLQTEVGLDIKWRVMNWKLAASDETRKLLSKAVAIFHERFDPIVDSSSGRDFIPTMLYGRNIRGQDFGGMYCAVLCVK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_150771

• Blastp: Increased DNA methylation 1 from Arabidopsis with 30.82% of identity
• Blastx: Increased DNA methylation 1 from Arabidopsis with 37% of identity
• Eggnog: PHD(ENOG410Y0W7)
• Kegg: Link to kegg annotations (AT3G14980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447799.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;