Protein coding transcript 235887

• Transcript: Ll_transcript_150467
• CDS coordinates: 275-829 (+)
• Peptide sequence: MDLGSESVEENEVNHDDGSFGNENFGFGFHGNLDAVTPKSDHKGTVDAVGSEEGGNSKGTSGKGVGLKKWKRIRRDVVKDPNSSADSGKILKRGLSGNANLSENQPFLRDVKEKGEEGSSNIFGNVEFSDGYAIRGSSTDSRYAVGSGFAVGADSENSEDRSSKSSTAASQPKLRSETSRSKNVR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_150467

• Blastp: WPP domain-interacting protein 1 from Arabidopsis with 44.09% of identity
• Blastx: WPP domain-interacting protein 1 from Arabidopsis with 44.09% of identity
• Eggnog: WPP domain-interacting protein(ENOG410YHC5)
• Kegg: Link to kegg annotations (AT4G26455)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431980.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;