Protein coding transcript 235888

• Transcript: Ll_transcript_150475
• CDS coordinates: 401-760 (+)
• Peptide sequence: MMMRYKEEKEAKKEAFRKYLESSGAVDALTKVLVSLYQQNDKPSSALQFIQNKLSCPSISEHEKLQAELSDLQIRYNELLTAHQKTCKELEELKSSHASAMTSTKEATDDESAKDGLGL*
• ORF Type: complete

Annotations of Ll_transcript_150475

• Blastp: C-Myc-binding protein from Bos with 42.31% of identity
• Blastx: C-Myc-binding protein from Bos with 43.06% of identity
• Eggnog: C-Myc binding protein(ENOG41126S1)
• Kegg: Link to kegg annotations (539291)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420356.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;