Protein coding transcript 235922

• Transcript: Ll_transcript_147988
• CDS coordinates: 746-1666 (+)
• Peptide sequence: MCPNDPDATKKLKECEKAVMKLKFEEAIAAPEAERHSIAESIDYKSIDVESQYSGARIEGDIITLDFVKKMMDDFKNQKCLHTRYAYQIVLQTRERLQALPSLVDINVPDGKHFTVCGDVHGQFYDLLNIFELNGLPSEENPYLFNGDFVDRGSFSLEVILTLFAFKCMSPSAIYLARGNHESKSMNKIYGFEGEVRSKLNDSFVELFAEVFCSLPLAHVINQKVFVVHGGLFSVDGVKLSDIRAINRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQENNLDLVVRSHEVK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_147988

• Blastp: Serine/threonine-protein phosphatase 5 from Arabidopsis with 72.58% of identity
• Blastx: Serine/threonine-protein phosphatase 5 from Arabidopsis with 66.6% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (AT2G42810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426309.1)
• Pfam: PPP5 TPR repeat region (PF08321.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;