Protein coding transcript 235930

• Transcript: Ll_transcript_147968
• CDS coordinates: 1038-2270 (+)
• Peptide sequence: METNHSKAEEFKLLANEAFGARKYAQAIELYTKAIELNSQNAVYLANRAFAHLRREEYGSAIQDATKAIEVDPKYSKGYYRRGTAHLAMGKFKEALKDFQQVKKLCPNDPDATKKLKECEKAVMKLKFEEAIAVPESLRHSVAESIDFHTIDVEPQYSGARIEGDVVTLDFVKKMMDDFKNQKFLHKRYAFQIVLQTRDILRALPSLVDINVPNGKHFTVCGDVHGQYYDLVNIFELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFAFKCMSPSAIYLARGNHESKSMNKIYGFEGEVRSKLNDSFVELFAEVFCSLPLAHVINQKVFVVHGGLFSVDGVKLSDIRAINRFCEPPEEGLMCELLWSDPQPLPGRGPSKRGVGLSFGADVTKRFLQENNLDLVVRSHEVK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_147968

• Blastp: Serine/threonine-protein phosphatase 5 from Arabidopsis with 59.11% of identity
• Blastx: Serine/threonine-protein phosphatase 5 from Arabidopsis with 59.19% of identity
• Eggnog: serine threonine-protein phosphatase(COG0639)
• Kegg: Link to kegg annotations (AT2G42810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456718.1)
• Pfam: Tetratricopeptide repeat (PF13181.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;