Protein coding transcript 235931

• Transcript: Ll_transcript_147969
• CDS coordinates: 288-809 (+)
• Peptide sequence: MVFFMLDVEPQYSGARIEGDVVTLDFVKNMMGDFKNQKFLHKRYAFQIVLQTREILRALPSLVDINVPTGKLFTVCGDVHGQYYDLLNIFELNGLPSEDNPYLFNGDFVDRGSFSLEVILTLFAFKCMSPSAIYLARGNHESKNMNKIYGFEGEVRSKLNETFVELFAEVFCCL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_147969

• Blastp: Serine/threonine-protein phosphatase 5 from Lycopersicon with 89.94% of identity
• Blastx: Serine/threonine-protein phosphatase 5 from Lycopersicon with 89.94% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (543849)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461786.1)
• Pfam: PPP5 TPR repeat region (PF08321.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;