| Transcript | Ll_transcript_293511 |
|---|---|
| CDS coordinates | 178-582 (+) |
| Peptide sequence | MGGERSVYTLAEISEHNTSKDCWLLIDGKVYNVTKFLDDHPGGGDVLLSSTGKDATDDFEDVGHSTGARAMLDEFYVGDIDSTTIPERTKNIPQTQPQNNQDNSSGFTVKLLQFLIPLIIFGFAVGIRFYNKSI* |
| ORF Type | complete |
| Blastp | Cytochrome b5 from Nicotiana with 74.24% of identity |
|---|---|
| Blastx | Cytochrome b5 from Nicotiana with 74.24% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (107781159) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450123.1) |
| Pfam | Cytochrome b5-like Heme/Steroid binding domain (PF00173.27) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer