Protein coding transcript 236000

• Transcript: Ll_transcript_149982
• CDS coordinates: 312-704 (+)
• Peptide sequence: MESDRKVPAQSDGVVQKGRALHGRTTGPTRRSTKGQWTPEEDEILCQAVQRFKGKNWKKIAECFKDRTDVQCLHRWQKVLNPELVKGPWSKEEDEIIISLVNKYGPKKWSNIAQHLPGRIGKQCRERYGL*
• ORF Type: complete

Annotations of Ll_transcript_149982

• Blastp: Transcription factor MYB3R-1 from Arabidopsis with 87.74% of identity
• Blastx: Transcription factor MYB3R-1 from Arabidopsis with 87.74% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT4G32730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438403.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;