Transcript | Ll_transcript_149124 |
---|---|
CDS coordinates | 1-306 (+) |
Peptide sequence | LIDTHLINSPQKSIKSSFFTLNSPISVYQIMTNDRKVGVAIDFSKSSKNALKWALENLANKGDTFYIIHINSNSDDESRNQLWAKSGSRELYIYISIFFSF* |
ORF Type | 5prime_partial |
Blastp | - |
---|---|
Blastx | Universal stress protein A-like protein from Arabidopsis with 41.51% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450281.1) |
Pfam | Universal stress protein family (PF00582.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer