Protein coding transcript 236006

• Transcript: Ll_transcript_149128
• CDS coordinates: 1-534 (+)
• Peptide sequence: LIDTHLINSPQKSIKSSFFTLNSPISVYQIMTNDRKVGVAIDFSKSSKNALKWALENLANKGDTFYIIHINSNSDDESRNQLWAKSGSPLIPLTEFRQTEVLSQYGLPTDAEFLDTLDTASRQKEINIIAKLYWGDAREKLLDSVEDLKLDSLVLGSRGLSTIQRCLLFLIFCFLLL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_149128

• Blastp: Universal stress protein PHOS32 from Arabidopsis with 27.34% of identity
• Blastx: Universal stress protein PHOS32 from Arabidopsis with 27.34% of identity
• Eggnog: Universal stress protein family(ENOG411179Q)
• Kegg: Link to kegg annotations (AT5G54430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450281.1)
• Pfam: Universal stress protein family (PF00582.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;