Protein coding transcript 236017

• Transcript: Ll_transcript_149132
• CDS coordinates: 488-892 (+)
• Peptide sequence: MSCFSYFKHKTRKLRQRSAPELNDREKSLYSGVDRSSGSTASPRGIPELYEEKAHNLRVFSYLELRHATNDFSRLFKIGEGGFGSVYKGTIKPVGGKGDPILVAIKRLNQDGLQVRDSEHFIGSNFISKCSNDT*
• ORF Type: complete

Annotations of Ll_transcript_149132

• Blastp: Probable serine/threonine-protein kinase PBL19 from Arabidopsis with 51.85% of identity
• Blastx: Probable serine/threonine-protein kinase PBL19 from Arabidopsis with 51.85% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G47070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453507.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;