Protein coding transcript 236023

• Transcript: Ll_transcript_149144
• CDS coordinates: 108-1136 (+)
• Peptide sequence: MEALPSASIAQQTWEFENNIIPIDTPSSTTNADDSIFHYDEAAQSEFHREKPWINDPHYFKRVKISALALLKMVVHARSGGTIEVMGLMQGKTDKDAIIVMDAFALPVEGTETRVNAQADAYEYMVDYSQTNKQAGRLENVVGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFLAVVIDPTRTVSAGKVEIGAFRTYPDGYKPPDEPISEYQTIPLNKIEDFGVHCKQYYSLDITYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAENQLAHSRFGSLISPAPRKKEEESPLAKITRDSAKITAEQVHGLMSQVIKDILFNSVH*
• ORF Type: complete

Annotations of Ll_transcript_149144

• Blastp: COP9 signalosome complex subunit 5b from Arabidopsis with 83.43% of identity
• Blastx: COP9 signalosome complex subunit 5b from Arabidopsis with 82.25% of identity
• Eggnog: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)(COG1310)
• Kegg: Link to kegg annotations (AT1G71230)
• CantataDB: Link to cantataDB annotations (CNT0000267)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438349.1)
• Pfam: JAB1/Mov34/MPN/PAD-1 ubiquitin protease (PF01398.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;