Protein coding transcript 236164

• Transcript: Ll_transcript_149381
• CDS coordinates: 2-298 (+)
• Peptide sequence: WDCDLYHGDWIYDQSGPLYTNNSCPIITQMQNCQGNGRPDKDYENFRWKPSQCDIPRFDPNFFLERMRGKTLAFIGDSVARNQMESMLCILWQGCSQHI
• ORF Type: internal

Annotations of Ll_transcript_149381

• Blastp: Protein trichome birefringence-like 18 from Arabidopsis with 80.43% of identity
• Blastx: Protein trichome birefringence-like 18 from Arabidopsis with 80.43% of identity
• Eggnog: Pfam:DUF231(ENOG410XREJ)
• Kegg: Link to kegg annotations (AT4G25360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439006.1)
• Pfam: PMR5 N terminal Domain (PF14416.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;