Protein coding transcript 236209

• Transcript: Ll_transcript_149966
• CDS coordinates: 38-928 (+)
• Peptide sequence: MSGSSCEQELGLMSINENSIKSSSVAPQNQNGNGSDQVNDIPGKDKYRDGSSSKAESNTKPPIPDHPAGTSNQCLPKFYCPGTKCPSICEDNMYPDFDMDEVDLNLENYDELFGMTLTHSEDLFENGGFDSLFGTKDISAEDSDCLGAVAAEGSSVELVNAMQPACSNAESADSILSTKTEPIICFTSRQVPSNISFSGIAGESNAGDYQDCGASSMLLMEEPHWHPHPENSLHSSVNRNNAVLRYKEKKKIRKFDKRVRYASRKERADVRKRVKGRFVKVGDAYDYDPLSPTRSY*
• ORF Type: complete

Annotations of Ll_transcript_149966

• Blastp: Zinc finger protein CONSTANS-LIKE 9 from Arabidopsis with 48.48% of identity
• Blastx: Zinc finger protein CONSTANS-LIKE 9 from Arabidopsis with 48.4% of identity
• Eggnog: Zinc finger protein CONSTANS-LIKE(ENOG410YA5C)
• Kegg: Link to kegg annotations (AT3G07650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420963.1)
• Pfam: CCT motif (PF06203.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;