| Transcript | Ll_transcript_149202 |
|---|---|
| CDS coordinates | 179-724 (+) |
| Peptide sequence | MYPGKNPLLPPKSPFPSVSQAYVDYVSNSAVGSKAVQKPREGNTHHQRTSSESHVMEEQPSWLDDLLNEPETPVRRGAHRRSSSDSSFAYLDTFNAANINYAEQNLLPIPSWVSQEFDHGKDAHHIPTYAEMNAAKQRNRSWDSFSNAMTHPDILPSTANEKYDSVESGIQDTKPSSERKDG |
| ORF Type | 3prime_partial |
| Blastp | Uncharacterized protein At4g06598 from Arabidopsis with 47.47% of identity |
|---|---|
| Blastx | Uncharacterized protein At4g06598 from Arabidopsis with 47.37% of identity |
| Eggnog | Transcription factor(ENOG410YFJG) |
| Kegg | Link to kegg annotations (AT4G06598) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019444131.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer