| Transcript | Ll_transcript_149024 |
|---|---|
| CDS coordinates | 35-373 (+) |
| Peptide sequence | MSGLLNDPGIKELAEQIAKDPSFNQMAEQLQKTFQGATPDSIPNFDNQQYLQTMQQVMQNPDFMTMAERLGNALVQDPSMSAMLESFSNPSNKEQIEERMARIKEDPSLKHIL |
| ORF Type | 3prime_partial |
| Blastp | Ankyrin repeat domain-containing protein 2B from Arabidopsis with 69.3% of identity |
|---|---|
| Blastx | Ankyrin repeat domain-containing protein 2B from Arabidopsis with 68% of identity |
| Eggnog | Ankyrin Repeat(COG0666) |
| Kegg | Link to kegg annotations (AT2G17390) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019427303.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer