Protein coding transcript 236330

• Transcript: Ll_transcript_149041
• CDS coordinates: 577-1380 (+)
• Peptide sequence: MAEQLQKTFQGTTQEGIPNFDNQQYFQTMQQVMQNPDFMTMAERLGSALMQDPSMSTMLESFTNPSNKEQLEERMARIKEDPSLKHILEEIETGGPSAMMRYWNDEEVLGKLGQAMGLANAGDAAASVENSVPDETDDAGNEDESIVHHTASTGDIEGLKSALAAGADKDEEDSEGRTALHFSCGYGEVKCAQILIEAGAKVDALDNNKNTALHYAAGYGRKECVALLLENGAAVTLQNLDGKTPIDVAKLNNQHEVLKLLEKDAFL*
• ORF Type: complete

Annotations of Ll_transcript_149041

• Blastp: Ankyrin repeat domain-containing protein 2A from Arabidopsis with 67.64% of identity
• Blastx: Ankyrin repeat domain-containing protein 2A from Arabidopsis with 70.03% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT4G35450)
• CantataDB: Link to cantataDB annotations (CNT0000133)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440907.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;