Protein coding transcript 2364

• Transcript: Ll_transcript_329277
• CDS coordinates: 33-533 (+)
• Peptide sequence: MMEDSKKSNKIREIVRLQQILKKWKKVANSNSNDNNNNNNSVSSSATTITTSGSGSKGIKFLKRTLSFSDVSSANHDIVPKGFLAVCVGKELKRFTIPTEYLRHQSFEILLREAEEEFGFQQEGVLKIPCQVSVFEQILKMVQSNKQSFNIACEVTTPTHHAQMCT*
• ORF Type: complete

Annotations of Ll_transcript_329277

• Blastp: Auxin-responsive protein SAUR71 from Arabidopsis with 48.39% of identity
• Blastx: Auxin-responsive protein SAUR71 from Arabidopsis with 48.39% of identity
• Eggnog: Auxin responsive protein(ENOG410YUJ0)
• Kegg: Link to kegg annotations (AT1G56150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448453.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;