Transcript | Ll_transcript_329277 |
---|---|
CDS coordinates | 33-533 (+) |
Peptide sequence | MMEDSKKSNKIREIVRLQQILKKWKKVANSNSNDNNNNNNSVSSSATTITTSGSGSKGIKFLKRTLSFSDVSSANHDIVPKGFLAVCVGKELKRFTIPTEYLRHQSFEILLREAEEEFGFQQEGVLKIPCQVSVFEQILKMVQSNKQSFNIACEVTTPTHHAQMCT* |
ORF Type | complete |
Blastp | Auxin-responsive protein SAUR71 from Arabidopsis with 48.39% of identity |
---|---|
Blastx | Auxin-responsive protein SAUR71 from Arabidopsis with 48.39% of identity |
Eggnog | Auxin responsive protein(ENOG410YUJ0) |
Kegg | Link to kegg annotations (AT1G56150) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448453.1) |
Pfam | Auxin responsive protein (PF02519.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer